PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GeBP
Protein Properties Length: 427aa    MW: 47460.4 Da    PI: 4.7618
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109557.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.71.8e-38170264397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     f r+wse+Dei++L+G+ d+kak+g++p++d+ af++f+kks++++vsksqlv+KirrLKkK+ ++ +k +++++p+fsk+h+  +f+lskkiWg
  XP_010109557.1 170 FARVWSEDDEIAVLKGMTDYKAKKGADPYADMGAFHDFIKKSLNADVSKSQLVDKIRRLKKKYLNNAAKGENDEDPVFSKPHELLSFKLSKKIWG 264
                     89********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.0E-34170264IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MAPKRLFEKP PPADSSLEDE YESDPADNEE KNGKGNENGS AGADDEEEKS GGDEAEEDES  60
PVKKPTVSKS DDSGSGSDTE SDDTPPSPSL SGFTIKPIVS RPMDDTADKH KKKSSVRPNK  120
RATESEDPES ETSEKDSKRK KKRKVTSASA SVTASKGGGD EEDSKKSLGF ARVWSEDDEI  180
AVLKGMTDYK AKKGADPYAD MGAFHDFIKK SLNADVSKSQ LVDKIRRLKK KYLNNAAKGE  240
NDEDPVFSKP HELLSFKLSK KIWGIGANKS PNGNNVEDSD LKSRSRLKTP VPSTPVSKST  300
TTVLALPNKE MSVKKEKKKR EQVEANGKVR VEKEEEDEDE EEEEEADEEG EEEEEFWDKY  360
PHLNKSLESC FSSEFKISLP LVETSKLEKI DKKWRELQIE ELGLFVRKAH LSQEQAELVL  420
GVLKRSV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137143KRKKKRK
2139144KKKRKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109557.10.0hypothetical protein L484_018292
TrEMBLW9SD900.0W9SD90_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.13e-29DNA-binding storekeeper protein-related transcriptional regulator